PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013633911.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 364aa    MW: 39673.7 Da    PI: 9.1719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013633911.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.9e-175095147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+te d  l ++v++lG+++W++I+r ++ gR++k+c++rw + 
   XP_013633911.1 50 KGPWSTEQDAVLTRLVNKLGPRNWTLISRGIP-GRSGKSCRLRWCNQ 95
                     79******************************.***********985 PP

2Myb_DNA-binding543.8e-17102145146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T eE+ ll  a++ +G++ W+ Ia+ ++ gRt++ +k++w++
   XP_013633911.1 102 RKPFTDEEENLLMSAHAVHGNK-WSVIAKLLP-GRTDNAIKNHWNS 145
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6294596IPR017930Myb domain
SuperFamilySSF466893.33E-2947143IPR009057Homeodomain-like
SMARTSM007171.2E-134998IPR001005SANT/Myb domain
PfamPF002494.3E-155095IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2351103IPR009057Homeodomain-like
CDDcd001671.56E-125294No hitNo description
PROSITE profilePS5129425.50297151IPR017930Myb domain
SMARTSM007171.6E-15101149IPR001005SANT/Myb domain
PfamPF002491.6E-15102145IPR001005SANT/Myb domain
CDDcd001674.71E-12104144No hitNo description
Gene3DG3DSA:1.10.10.605.1E-24104150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MNSEIVSQMP PATPSTPFDD NAAVDLELAA ALGGGGGGDS NGGCGRSKAK GPWSTEQDAV  60
LTRLVNKLGP RNWTLISRGI PGRSGKSCRL RWCNQLDPCL KRKPFTDEEE NLLMSAHAVH  120
GNKWSVIAKL LPGRTDNAIK NHWNSALKRK HADLWNSHHH SISNASSSRK EETNYHPPSV  180
STDVKMEGEA SKTREGKCCK PGVYRPVARL GAFSVYRPGY MNQRVAPCEG PLVQAARTDS  240
LGGQFLQSLC YQPNVPSRCG HGCCNQQPEK RLSSSVLGPE FVDYEGPSSV GLDQELVSIA  300
TDLNNIAWIR SGLNNSSYSR EVGQSLSVGN HLRFEHARAR GKFTGMVNNG MPSQMLRQDL  360
RALI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-36501507107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013633911.10.0PREDICTED: uncharacterized protein LOC106339611
TrEMBLA0A0D3BQF30.0A0A0D3BQF3_BRAOL; Uncharacterized protein
STRINGBra005006.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G39880.11e-129myb domain protein 25